Structure of PDB 1qn4 Chain B Binding Site BS01

Receptor Information
>1qn4 Chain B (length=187) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVI
MRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFK
DFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIV
LLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qn4 TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
Resolution1.86 Å
Binding residue
(original residue number in PDB)
V29 A58 F74 S76 K78 V80 Q116 N117 L147 F148 I152 R154 L163 T173
Binding residue
(residue number reindexed from 1)
V18 A47 F63 S65 K67 V69 Q105 N106 L136 F137 I141 R143 L152 T162
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006352 DNA-templated transcription initiation
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1qn4, PDBe:1qn4, PDBj:1qn4
PDBsum1qn4
PubMed10617571
UniProtP28147|TBP1_ARATH TATA-box-binding protein 1 (Gene Name=TBP1)

[Back to BioLiP]