Structure of PDB 1qfq Chain B Binding Site BS01

Receptor Information

>1qfq Chain B (length=35) Species: 10710 (Lambdavirus lambda)

DAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRP

Ligand information

>1qfq Chain A (length=15)

gcccugaaaaagggc

<<<<<.....>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1qfq Antitermination in bacteriophage lambda. The structure of the N36 peptide-boxB RNA complex
• Resolution: N/A
• Binding residue (original residue number in PDB): D2 A3 Q4 R6 R7 R8 R11 K14 Q15 W18 K19
• Binding residue (residue number reindexed from 1): D1 A2 Q3 R5 R6 R7 R10 K13 Q14 W17 K18
• Binding affinity: PDBbind-CN: Kd=20nM

External links

• PDB: RCSB:1qfq, PDBe:1qfq, PDBj:1qfq
• PDBsum: 1qfq
• PubMed: 10759866
• UniProt: P03045|REGN_LAMBD Antitermination protein N (Gene Name=N)