Structure of PDB 1qc6 Chain B Binding Site BS01

Receptor Information
>1qc6 Chain B (length=108) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSEQSICQARASVMVYDDTSKKWVPIKFSRINIYHNTASSTFRVVGVKLQ
DQQVVINYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAM
LFALNIMN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qc6 Structure of EVH1, a novel proline-rich ligand-binding module involved in cytoskeletal dynamics and neural function
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y2016 W2023 N2072 T2075 F2078 Q2080 W2081 R2082
Binding residue
(residue number reindexed from 1)		Y16 W23 N67 T70 F73 Q75 W76 R77
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1qc6, PDBe:1qc6, PDBj:1qc6
PDBsum1qc6
PubMed10404224
UniProtP70429|EVL_MOUSE Ena/VASP-like protein (Gene Name=Evl)

[Back to BioLiP]