Structure of PDB 1q3p Chain B Binding Site BS01

Receptor Information
>1q3p Chain B (length=103) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSDYIIKEKTVLLQKKDSEGFGFVLRGAIEEFTPTPAFPALQYLESVDEG
GVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR
HPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1q3p Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization
Resolution2.25 Å
Binding residue
(original residue number in PDB)		G601 F602 G603 F604 V605 L606 R607 G608 Y629 E631 D634 H663
Binding residue
(residue number reindexed from 1)		G20 F21 G22 F23 V24 L25 R26 G27 Y43 E45 D48 H77
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1q3p, PDBe:1q3p, PDBj:1q3p
PDBsum1q3p
PubMed12954649
UniProtQ9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 (Gene Name=Shank1)

[Back to BioLiP]