Structure of PDB 1pz5 Chain B Binding Site BS01

Receptor Information
>1pz5 Chain B (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVKVEESGGGLVQPGGSMKLSCVASGFTFSNYWMEWVRQSPEKGLEWVAE
IRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTR
GGAVGAMDYWGQGTSVTVSSATTTAPSVYPLVPGCSDTSGSSVTLGCLVK
GYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTV
ICNVAHPASKVDLIKEISGP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pz5 Structural basis of peptide-carbohydrate mimicry in an antibody combining site.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		W33 H58 G95 G99
Binding residue
(residue number reindexed from 1)		W33 H61 G101 G105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003823 antigen binding
Biological Process
GO:0002250 adaptive immune response
GO:0016064 immunoglobulin mediated immune response
Cellular Component
GO:0019814 immunoglobulin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1pz5, PDBe:1pz5, PDBj:1pz5
PDBsum1pz5
PubMed14645714
UniProtP01801|HVM32_MOUSE Ig heavy chain V-III region J606

[Back to BioLiP]