Structure of PDB 1pyo Chain B Binding Site BS01

Receptor Information
>1pyo Chain B (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHV
ADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPP
Ligand information
>1pyo Chain E (length=5) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDESD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pyo Crystal structure of caspase-2, apical initiator of the intrinsic apoptotic pathway.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		A229 M230 R231 N232 T233 W238 G272 Y273 F279
Binding residue
(residue number reindexed from 1)		A23 M24 R25 N26 T27 W32 G66 Y67 F73
Enzymatic activity
Enzyme Commision number 3.4.22.55: caspase-2.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1pyo, PDBe:1pyo, PDBj:1pyo
PDBsum1pyo
PubMed12920126
UniProtP42575|CASP2_HUMAN Caspase-2 (Gene Name=CASP2)

[Back to BioLiP]