Structure of PDB 1pvp Chain B Binding Site BS01

Receptor Information
>1pvp Chain B (length=318) Species: 10678 (Punavirus P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEP
EDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMR
RIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAY
NTLLRAAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVT
KLVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSLSALHGIFGAT
HRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNV
NIVMNYIRTGAMVRLLED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pvp A specificity switch in selected cre recombinase variants is mediated by macromolecular plasticity and water.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		K43 M44 S47 R50 R81 L83 A84 K86 T87 Q90 A131 K132 R154 Q156 R159 R173 K201 T202 R241 V242 K244 L256 S257 S259 A260 R282 Y283 W315 T316 N317 I320 Y324
Binding residue
(residue number reindexed from 1)		K25 M26 S29 R32 R63 L65 A66 K68 T69 Q72 A113 K114 R136 Q138 R141 R155 K183 T184 R223 V224 K226 L238 S239 S241 A242 R264 Y265 W297 T298 N299 I302 Y306
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1pvp, PDBe:1pvp, PDBj:1pvp
PDBsum1pvp
PubMed14652076
UniProtP06956|RECR_BPP1 Recombinase cre (Gene Name=cre)

[Back to BioLiP]