Structure of PDB 1ph1 Chain B Binding Site BS01

Receptor Information
>1ph1 Chain B (length=217) Species: 200597 (Sterkiella nova) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQQQSAFKQLYTELFNNEGDFSKVSSNLKKPLKCYVKESYPHFLVTDGYF
FVAPYFTKEAVNEFHAKFPNVNIVDLTDKVIVINNWSLELRRVNSAEVFT
SYANLEARLIVHSFKPNLQERLNPTRYPVNLFRDDEFKTTIQHFRHTALQ
AAINKTVKGDNLVDISKVADAAGKKGKVDAGIVKASASKGDEFSDFSFKE
GNTATLKIADIFVQEKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ph1 Nucleotide Shuffling and Ssdna Recognition in Oxytricha Nova Telomere End-Binding Protein Complexes
Resolution2.51 Å
Binding residue
(original residue number in PDB)		E45 H49 F106 Y109 Y134 R140 K145
Binding residue
(residue number reindexed from 1)		E38 H42 F99 Y102 Y127 R133 K138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042162 telomeric DNA binding
Cellular Component
GO:0000781 chromosome, telomeric region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1ph1, PDBe:1ph1, PDBj:1ph1
PDBsum1ph1
PubMed12912928
UniProtP16458|TEBB_STENO Telomere-binding protein subunit beta (Gene Name=MAC-41A)

[Back to BioLiP]