Structure of PDB 1pfi Chain B Binding Site BS01

Receptor Information
>1pfi Chain B (length=46) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pfi Pf1 virus structure: helical coat protein and DNA with paraxial phosphates.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
S41 M42 K45
Binding residue
(residue number reindexed from 1)
S41 M42 K45
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1pfi, PDBe:1pfi, PDBj:1pfi
PDBsum1pfi
PubMed8036516
UniProtP03621|CAPSD_BPPF1 Capsid protein G8P (Gene Name=VIII)

[Back to BioLiP]