Structure of PDB 1pb0 Chain B Binding Site BS01

Receptor Information

>1pb0 Chain B (length=235) Species: 562 (Escherichia coli)

MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHH
WHFINMRIWPRVVDGVGILRGIEANIKNVDGEIDCSGKMFDSLDLIIAGF
HEPVFAPHDKATNTQAMIATIASGNVHIISHPGNPKYEIDVKAVAEAAAK
HQVALEINFLHNCREVAAAVRDAGGWVALGSDSHTAFTMGEFEECLKILD
AVDFPPERILNVSPRRLLNFLESRGMAPIAEFADL

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 1pb0 Chain B Residue 1311

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1pb0 Crystal structure of the Escherichia coli YcdX protein reveals a trinuclear zinc active site.
• Resolution: 1.95 Å
• Binding residue (original residue number in PDB): H15 H40 H164 H194
• Binding residue (residue number reindexed from 1): H15 H40 H161 H184
• Annotation score: 4

Enzymatic activity

• Enzyme Commision number: 3.1.3.-

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0016791 phosphatase activity
• GO:0042578 phosphoric ester hydrolase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0071978 bacterial-type flagellum-dependent swarming motility

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:1pb0, PDBe:1pb0, PDBj:1pb0
• PDBsum: 1pb0
• UniProt: P75914|YCDX_ECOLI Probable phosphatase YcdX (Gene Name=ycdX)