Structure of PDB 1par Chain B Binding Site BS01

Receptor Information
>1par Chain B (length=53) Species: 10754 (Lederbergvirus P22) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGR
IGA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1par DNA recognition by beta-sheets in the Arc repressor-operator crystal structure.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Q9 N11
Binding residue
(residue number reindexed from 1)		Q9 N11
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1par, PDBe:1par, PDBj:1par
PDBsum1par
PubMed8107872
UniProtP03050|RARC_BPP22 Transcriptional repressor arc (Gene Name=arc)

[Back to BioLiP]