Structure of PDB 1p8d Chain B Binding Site BS01

Receptor Information

>1p8d Chain B (length=239) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGASRDARQQRFAH
FTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRY
NHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEY
ALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPR
MLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV

Ligand information

>1p8d Chain D (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RHKILHRLLQEGS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1p8d X-ray crystal structure of the liver X receptor beta ligand binding domain: regulation by a histidine-tryptophan switch.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	V283 K287 R297 I301 K305 L452 E455
Binding residue (residue number reindexed from 1)	V63 K67 R77 I81 K85 L232 E235

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006629	lipid metabolic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1p8d, PDBe:1p8d, PDBj:1p8d
PDBsum	1p8d
PubMed	12736258
UniProt	P55055\|NR1H2_HUMAN Oxysterols receptor LXR-beta (Gene Name=NR1H2)

[Back to BioLiP]