Structure of PDB 1p78 Chain B Binding Site BS01

Receptor Information
>1p78 Chain B (length=92) Species: 1167 (Anabaena sp.) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNKGELVDAVAEKASVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSF
ESRERKAREGRNPKTNEKMEIPATRVPAFSAGKLFREKVAPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p78 Flexible DNA bending in HU-DNA cocrystal structures
Resolution2.25 Å
Binding residue
(original residue number in PDB)		R58 G60 R61 N62 P63 K64 M69 I71
Binding residue
(residue number reindexed from 1)		R58 G60 R61 N62 P63 K64 M69 I71
Binding affinityPDBbind-CN: Kd=3.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0030261 chromosome condensation
GO:0043158 heterocyst development
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1p78, PDBe:1p78, PDBj:1p78
PDBsum1p78
PubMed12853489
UniProtP05514|DBH_NOSS1 DNA-binding protein HU (Gene Name=hup)

[Back to BioLiP]