Structure of PDB 1p47 Chain B Binding Site BS01

Receptor Information
>1p47 Chain B (length=84) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTT
HIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p47 Constraints for Zinc Finger Linker Design as Inferred from X-ray Crystal Structure of Tandem Zif268-DNA Complexes
Resolution2.2 Å
Binding residue
(original residue number in PDB)		F116 R118 R124 H125 R142 R146 H149 H153 T156 R170 R174 E177 R180 H181 I184
Binding residue
(residue number reindexed from 1)		F14 R16 R22 H23 R40 R44 H47 H51 T54 R68 R72 E75 R78 H79 I82
Binding affinityPDBbind-CN: Kd=2.1fM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1p47, PDBe:1p47, PDBj:1p47
PDBsum1p47
PubMed12818197
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]