Structure of PDB 1p13 Chain B Binding Site BS01

Receptor Information
>1p13 Chain B (length=102) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNA
KGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNV
CP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p13 The structure of the membrane distal phosphatase domain of RPTPalpha reveals interdomain flexibility and an SH2 domain interaction region.
Resolution1.63 Å
Binding residue
(original residue number in PDB)
R168 R188 H214 Y215 K216 I227 T228 R230 G249
Binding residue
(residue number reindexed from 1)
R11 R31 H57 Y58 K59 I70 T71 R73 G92
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1p13, PDBe:1p13, PDBj:1p13
PDBsum1p13
PubMed12834342
UniProtP00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]