Structure of PDB 1ozj Chain B Binding Site BS01

Receptor Information
>1ozj Chain B (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQ
NVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMEL
CEFAFNMKKDEVCVNPYHYQRVET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ozj Features of a Smad3 MH1-DNA complex. Roles of water and zinc in DNA binding.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		S70 L71 Q76 S78 K81
Binding residue
(residue number reindexed from 1)		S62 L63 Q68 S70 K73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ozj, PDBe:1ozj, PDBj:1ozj
PDBsum1ozj
PubMed12686552
UniProtP84022|SMAD3_HUMAN Mothers against decapentaplegic homolog 3 (Gene Name=SMAD3)

[Back to BioLiP]