Structure of PDB 1owg Chain B Binding Site BS01

Receptor Information
>1owg Chain B (length=94) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGS
FSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1owg Integration Host Factor: putting a twist on protein-DNA recognition
Resolution2.1 Å
Binding residue
(original residue number in PDB)		S4 K27 E44 R46 G47 S50 R59 R62 N63 P64 K75 G83 K84
Binding residue
(residue number reindexed from 1)		S4 K27 E44 R46 G47 S50 R59 R62 N63 P64 K75 G83 K84
Binding affinityPDBbind-CN: Kd=200nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
Cellular Component
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:1990177 IHF-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1owg, PDBe:1owg, PDBj:1owg
PDBsum1owg
PubMed12842466
UniProtP0A6Y1|IHFB_ECOLI Integration host factor subunit beta (Gene Name=ihfB)

[Back to BioLiP]