Structure of PDB 1ow7 Chain B Binding Site BS01

Receptor Information
>1ow7 Chain B (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVG
LALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYV
MTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ow7 Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain
Resolution2.6 Å
Binding residue
(original residue number in PDB)		K955 G958 L959 R962 N991 M1001
Binding residue
(residue number reindexed from 1)		K47 G50 L51 R54 N83 M93
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Molecular Function
GO:0004713 protein tyrosine kinase activity
Biological Process
GO:0006468 protein phosphorylation
GO:0007172 signal complex assembly
Cellular Component
GO:0005925 focal adhesion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ow7, PDBe:1ow7, PDBj:1ow7
PDBsum1ow7
PubMed14527389
UniProtQ05397|FAK1_HUMAN Focal adhesion kinase 1 (Gene Name=PTK2)

[Back to BioLiP]