Structure of PDB 1otc Chain B Binding Site BS01

Receptor Information

>1otc Chain B (length=213) Species: 200597 (Sterkiella nova) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QQSAFKQLYTELFNNEGDFSKVSSNLKKPLKCYVKESYPHFLVTDGYFFV
APYFTKEAVNEFHAKFPNVNIVDLTDKVIVINNWSLELRRVNSAEVFTSY
ANLEARLIVHSFKPNLQERLNPTRYPVNLFRDDEFKTTIQHFRHTALQAA
INKTVKGDNLVDISKVADAAGKKGKVDAGIVKASASKGDEFSDFSFKEGN
TATLKIADIFVQE

Ligand information

>1otc Chain D (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggggttttgggg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1otc Crystal structure of the Oxytricha nova telomere end binding protein complexed with single strand DNA.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	E45 H49 L51 F106 Y109 Y134 R140
Binding residue (residue number reindexed from 1)	E36 H40 L42 F97 Y100 Y125 R131

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0042162	telomeric DNA binding

	Cellular Component
GO:0000781	chromosome, telomeric region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1otc, PDBe:1otc, PDBj:1otc
PDBsum	1otc
PubMed	9875850
UniProt	P16458\|TEBB_STENO Telomere-binding protein subunit beta (Gene Name=MAC-41A)

[Back to BioLiP]