Structure of PDB 1om9 Chain B Binding Site BS01

Receptor Information
>1om9 Chain B (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSM
LSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLL
LANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1om9 Structural basis for binding of accessory proteins by the appendage domain of GGAs
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q561 S562 A563 V564 P565 K566 V570 L572 R609 K611
Binding residue
(residue number reindexed from 1)		Q64 S65 A66 V67 P68 K69 V73 L75 R112 K114
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0031267 small GTPase binding
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0005802 trans-Golgi network

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1om9, PDBe:1om9, PDBj:1om9
PDBsum1om9
PubMed12858163
UniProtQ9UJY5|GGA1_HUMAN ADP-ribosylation factor-binding protein GGA1 (Gene Name=GGA1)

[Back to BioLiP]