Structure of PDB 1oeb Chain B Binding Site BS01

Receptor Information
>1oeb Chain B (length=55) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANY
VAPMM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1oeb Structural Basis for SH3 Domain-Mediated High-Affinity Binding between Mona/Gads and Slp-76
Resolution1.76 Å
Binding residue
(original residue number in PDB)		Y8 F10 E14 D16 E17 S35 W36 L47 N51 Y52
Binding residue
(residue number reindexed from 1)		Y6 F8 E12 D14 E15 S33 W34 L45 N49 Y50
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1oeb, PDBe:1oeb, PDBj:1oeb
PDBsum1oeb
PubMed12773374
UniProtO89100|GRAP2_MOUSE GRB2-related adaptor protein 2 (Gene Name=Grap2)

[Back to BioLiP]