Structure of PDB 1oby Chain B Binding Site BS01

Receptor Information
>1oby Chain B (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNV
IGLKDSQIADILSTSGTVVTITIM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1oby Molecular Roots of Degenerate Specificity in Syntenin'S Pdz2 Domain: Reassessment of the Pdz Recognition Paradigm
Resolution1.85 Å
Binding residue
(original residue number in PDB)
H208 I212
Binding residue
(residue number reindexed from 1)
H12 I16
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1oby, PDBe:1oby, PDBj:1oby
PDBsum1oby
PubMed12842047
UniProtO00560|SDCB1_HUMAN Syntenin-1 (Gene Name=SDCBP)

[Back to BioLiP]