Structure of PDB 1nzl Chain B Binding Site BS01

Receptor Information
>1nzl Chain B (length=103) Species: 11889 (Rous sarcoma virus (strain Schmidt-Ruppin)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNA
KGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNV
CPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nzl Structural and Thermodynamic Basis for the Interaction of the Src SH2 domain with the Activated form of the PDGF beta-receptor
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R261 R281 S283 E284 T285 K306 H307 Y308 K309 I320 G342
Binding residue
(residue number reindexed from 1)		R11 R31 S33 E34 T35 K56 H57 Y58 K59 I70 G92
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1nzl, PDBe:1nzl, PDBj:1nzl
PDBsum1nzl
PubMed12706723
UniProtP00524|SRC_RSVSA Tyrosine-protein kinase transforming protein Src (Gene Name=V-SRC)

[Back to BioLiP]