Structure of PDB 1nzb Chain B Binding Site BS01

Receptor Information
>1nzb Chain B (length=322) Species: 10678 (Punavirus P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPE
DVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRR
IRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYN
TLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTK
LVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATH
RLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVN
IVMNYIRNLDSETGAMVRLLED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nzb Crystal structure of a wild-type Cre recombinase-loxP synapse reveals a novel spacer conformation suggesting an alternative mechanism for DNA cleavage activation
Resolution3.1 Å
Binding residue
(original residue number in PDB)
K43 M44 R81 L83 A84 K86 T87 Q90 A131 K132 R159 R173 K201 T202 R241 V242 K244 L256 S257 R259 R282 R292 W315 T316 N317 Y324
Binding residue
(residue number reindexed from 1)
K24 M25 R62 L64 A65 K67 T68 Q71 A112 K113 R140 R154 K182 T183 R222 V223 K225 L237 S238 R240 R263 R273 W296 T297 N298 Y305
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1nzb, PDBe:1nzb, PDBj:1nzb
PDBsum1nzb
PubMed12954782
UniProtP06956|RECR_BPP1 Recombinase cre (Gene Name=cre)

[Back to BioLiP]