Structure of PDB 1nkp Chain B Binding Site BS01

Receptor Information
>1nkp Chain B (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQ
YMRRKNHTHQQDIDDLKRQNALLEQQVRALGGC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nkp X-ray structures of Myc-Max and Mad-Max recognizing DNA: Molecular bases of regulation by proto-oncogenic transcription factors
Resolution1.8 Å
Binding residue
(original residue number in PDB)
R204 H207 N208 E211 R212 R215 K219 S238 R239
Binding residue
(residue number reindexed from 1)
R3 H6 N7 E10 R11 R14 K18 S37 R38
Binding affinityPDBbind-CN: Kd=90nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:1nkp, PDBe:1nkp, PDBj:1nkp
PDBsum1nkp
PubMed12553908
UniProtP61244|MAX_HUMAN Protein max (Gene Name=MAX)

[Back to BioLiP]