Structure of PDB 1nkk Chain B Binding Site BS01

Receptor Information
>1nkk Chain B (length=226) Species: 10359 (Human betaherpesvirus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQQSQAVAPVYVGGFLARYDQSPDEARLLLPRDVVEHWLHAQVALPLNIN
HDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASEKSELVSRGPV
SPLQPDKVVEFLSGSYAGLSLSSRRCDETTPFKHVALCSVGRRRGTLAVY
GRDPEWVTQRFPDLTAADRDGLRAQWQRCGGDPFRSDSYGLLGNSVDALY
IRERLPKLRYDKQLVGVTERESYVKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nkk Structural and Biochemical Studies of Inhibitor Binding to Human Cytomegalovirus Protease
Resolution2.6 Å
Binding residue
(original residue number in PDB)
R331 H363 S432 L433 S434 S435 R436 R437 G464 R465
Binding residue
(residue number reindexed from 1)
R27 H51 S120 L121 S122 S123 R124 R125 G141 R142
Enzymatic activity
Catalytic site (original residue number in PDB) H363 S432 S434 H457 R465 R466
Catalytic site (residue number reindexed from 1) H51 S120 S122 H134 R142 R143
Enzyme Commision number 3.4.21.97: assemblin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1nkk, PDBe:1nkk, PDBj:1nkk
PDBsum1nkk
PubMed12549906
UniProtP16753|SCAF_HCMVA Capsid scaffolding protein (Gene Name=UL80)

[Back to BioLiP]