Structure of PDB 1njt Chain B Binding Site BS01

Receptor Information
>1njt Chain B (length=227) Species: 10359 (Human betaherpesvirus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQALPLN
INHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASEKSELVSRG
PVSPLQPDKVVEFLSGSYAGLSLSSRRCDTTPFKHVALCSVGRRRGTLAV
YGRDPEWVTQRFPDLTAADRDGLRAQWQRCSGDPFRSDSYGLLGNSVDAL
YIRERLPKLRYDKQLVGVTERESYVKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1njt Structural and Biochemical Studies of Inhibitor Binding to Human Cytomegalovirus Protease
Resolution2.5 Å
Binding residue
(original residue number in PDB)		H363 S432 L433 S434 S435 R436 R437 K456 G464 R465
Binding residue
(residue number reindexed from 1)		H53 S122 L123 S124 S125 R126 R127 K134 G142 R143
Enzymatic activity
Catalytic site (original residue number in PDB) H363 S432 S434 H457 R465 R466
Catalytic site (residue number reindexed from 1) H53 S122 S124 H135 R143 R144
Enzyme Commision number 3.4.21.97: assemblin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1njt, PDBe:1njt, PDBj:1njt
PDBsum1njt
PubMed12549906
UniProtP16753|SCAF_HCMVA Capsid scaffolding protein (Gene Name=UL80)

[Back to BioLiP]