Structure of PDB 1n5z Chain B Binding Site BS01

Receptor Information
>1n5z Chain B (length=69) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRT
KNGNIGYIPYNYIEIIKRR
Ligand information
>1n5z Chain Q (length=10) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MPPTLPHRDW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1n5z Topography for Independent Binding of alpha-Helical and PPII-Helical Ligands to a Peroxisomal SH3 Domain
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y21 E26 M30 D47 R51 W55 P69 N71 Y72
Binding residue
(residue number reindexed from 1)		Y11 E16 M20 D37 R41 W45 P59 N61 Y62
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1n5z, PDBe:1n5z, PDBj:1n5z
PDBsum1n5z
PubMed12453410
UniProtP80667|PEX13_YEAST Peroxisomal membrane protein PEX13 (Gene Name=PEX13)

[Back to BioLiP]