Structure of PDB 1mvu Chain B Binding Site BS01

Receptor Information
>1mvu Chain B (length=121) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWIGR
IDPANDNTKYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARRE
LYSYYSPLDVWGAGTTVTVPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mvu A Single Chain Fv Fragment of P-Glycoprotein-Specific Monoclonal Antibody C219. Design, Expression, and Crystal Structure at 2.4 A Resolution
Resolution1.78 Å
Binding residue
(original residue number in PDB)		R99 L101 S103 Y104 Y105
Binding residue
(residue number reindexed from 1)		R99 L101 S103 Y104 Y105
Enzymatic activity
Enzyme Commision number ?
External links