Structure of PDB 1mv0 Chain B Binding Site BS01

Receptor Information
>1mv0 Chain B (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGW
LMGVKESDWNQHKKLEKCRGVFPENFTERVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mv0 A structure-based model of the c-Myc/Bin1 protein interaction shows alternative splicing of Bin1 and c-Myc phosphorylation are key binding determinants.
ResolutionN/A
Binding residue
(original residue number in PDB)		Q417 H418 D424 D426 Q442 E446 D448 W451 M453 V472
Binding residue
(residue number reindexed from 1)		Q16 H17 D23 D25 Q41 E45 D47 W50 M52 V71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1mv0, PDBe:1mv0, PDBj:1mv0
PDBsum1mv0
PubMed15992821
UniProtO00499|BIN1_HUMAN Myc box-dependent-interacting protein 1 (Gene Name=BIN1)

[Back to BioLiP]