Structure of PDB 1muj Chain B Binding Site BS01

Receptor Information

>1muj Chain B (length=184) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTE
LGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVI
SLSHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVL
VMLEMTPRRGEVYTCHVEHPSLKSPITVEWSSAE

Ligand information

>1muj Chain C (length=15) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PVSKMRMATPLLMQA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1muj Crystal structure of MHC class II I-Ab in complex with a human CLIP peptide: Prediction of an I-Ab peptide-binding motif
Resolution	2.15 Å
Binding residue (original residue number in PDB)	F11 Y30 H47 Y60 W61 I67 R70 E74 T77 V78 H81 N82 P85
Binding residue (residue number reindexed from 1)	F9 Y28 H45 Y58 W59 I65 R68 E72 T75 V76 H79 N80 P84

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1muj, PDBe:1muj, PDBj:1muj
PDBsum	1muj
PubMed	12589760
UniProt	P14483\|HB2A_MOUSE H-2 class II histocompatibility antigen, A beta chain (Gene Name=H2-Ab1)

[Back to BioLiP]