Structure of PDB 1mnm Chain B Binding Site BS01

Receptor Information
>1mnm Chain B (length=81) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETG
LVYTFSTPKFEPIVTQQEGRNLIQACLNAPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mnm Crystal structure of the yeast MATalpha2/MCM1/DNA ternary complex.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		T35 K38 R39 K45
Binding residue
(residue number reindexed from 1)		T18 K21 R22 K28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1mnm, PDBe:1mnm, PDBj:1mnm
PDBsum1mnm
PubMed9490409
UniProtP11746|MCM1_YEAST Pheromone receptor transcription factor (Gene Name=MCM1)

[Back to BioLiP]