Structure of PDB 1mk7 Chain B Binding Site BS01

Receptor Information

>1mk7 Chain B (length=192) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPG
FLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTY
GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKR
WAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL

Ligand information

>1mk7 Chain A (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HMWDTANNPLYKE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1mk7 Structural Determinants of Integrin Recognition by Talin
Resolution	2.2 Å
Binding residue (original residue number in PDB)	P209 V210 Q211 L212 K300
Binding residue (residue number reindexed from 1)	P1 V2 Q3 L4 K92

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Cellular Component
GO:0005856	cytoskeleton

View graph for
Cellular Component

External links

PDB	RCSB:1mk7, PDBe:1mk7, PDBj:1mk7
PDBsum	1mk7
PubMed	12535520
UniProt	P54939\|TLN1_CHICK Talin-1 (Gene Name=TLN1)

[Back to BioLiP]