Structure of PDB 1mji Chain B Binding Site BS01

Receptor Information
>1mji Chain B (length=179) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARIL
EKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFL
EKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALR
GMDIAVVTTAETDEEARALLELLGFPFRK
Ligand information
>1mji Chain C (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcaccugaccccaugccgaacucagaagugccc
<<<<<<<<...............>>>..>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mji Detailed analysis of RNA-protein interactions within the bacterial ribosomal protein L5/5S rRNA complex
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q66 K67 A69 V70 R91 V92 T93 R95 R96 R98
Binding residue
(residue number reindexed from 1)		Q63 K64 A66 V67 R88 V89 T90 R92 R93 R95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mji, PDBe:1mji, PDBj:1mji
PDBsum1mji
PubMed12515387
UniProtP41201|RL5_THETH Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]