Structure of PDB 1mfq Chain B Binding Site BS01

Receptor Information
>1mfq Chain B (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLE
KNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIP
KLKTRTQ
Ligand information
>1mfq Chain A (length=128) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gacacuaaguucggcaucaauauggugaccucccgggagcgggggaccac
cagguugccuaaggaggggugaaccggcccaggucggaaacggagcaggu
caaaacucccgugcugaucaguaguguc
<<<<<<<.<.<<<<<<<<<<<.<<<<<..<<<<<<....>>>>>>..>>>
>>.>>>>........<<<<<.....<<<<..<.<<<....>>>..>.>>>
>...>>>>>.>>>>>>>.>..>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mfq Induced structural changes of 7SL RNA during the assembly of human signal recognition particle
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R14 F15 I16 C17 Y19 Y22 T28 I29 R33 R34 P36 K66 M67 Y68 S69 R70 R74 R81 R83 R101
Binding residue
(residue number reindexed from 1)		R1 F2 I3 C4 Y6 Y9 T15 I16 R20 R21 P23 K53 M54 Y55 S56 R57 R61 R68 R70 R88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mfq, PDBe:1mfq, PDBj:1mfq
PDBsum1mfq
PubMed12244299
UniProtP09132|SRP19_HUMAN Signal recognition particle 19 kDa protein (Gene Name=SRP19)

[Back to BioLiP]