Structure of PDB 1mcl Chain B Binding Site BS01

Receptor Information

>1mcl Chain B (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVII
YEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFV
FGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVT
HEGSTVEKTVAPTECS

Ligand information

>1mcl Chain P (length=2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1mcl Principles and pitfalls in designing site-directed peptide ligands.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	Y34 Y93 F99
Binding residue (residue number reindexed from 1)	Y34 Y93 F99

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1mcl, PDBe:1mcl, PDBj:1mcl
PDBsum	1mcl
PubMed	8346191
UniProt	Q6PIK1

[Back to BioLiP]