Structure of PDB 1mch Chain B Binding Site BS01

Receptor Information

>1mch Chain B (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVII
YEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFV
FGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVT
HEGSTVEKTVAPTECS

Ligand information

>1mch Chain P (length=6) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QFHPAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1mch Principles and pitfalls in designing site-directed peptide ligands.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	Y34 S36 Y38 S91 Y93 F99 F101
Binding residue (residue number reindexed from 1)	Y34 S36 Y38 S91 Y93 F99 F101

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1mch, PDBe:1mch, PDBj:1mch
PDBsum	1mch
PubMed	8346191
UniProt	Q6PIK1

[Back to BioLiP]