Structure of PDB 1mce Chain B Binding Site BS01

Receptor Information

>1mce Chain B (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVII
YEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFV
FGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVT
HEGSTVEKTVAPTECS

Ligand information

>1mce Chain P (length=5) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QFHPA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1mce Principles and pitfalls in designing site-directed peptide ligands.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	Y34 Y38 V48 Y51 S91
Binding residue (residue number reindexed from 1)	Y34 Y38 V48 Y51 S91

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0002250	adaptive immune response

	Cellular Component
GO:0005576	extracellular region
GO:0005886	plasma membrane
GO:0019814	immunoglobulin complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1mce, PDBe:1mce, PDBj:1mce
PDBsum	1mce
PubMed	8346191
UniProt	P0DOX8\|IGL1_HUMAN Immunoglobulin lambda-1 light chain

[Back to BioLiP]