Structure of PDB 1ma7 Chain B Binding Site BS01

Receptor Information
>1ma7 Chain B (length=317) Species: 10678 (Punavirus P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPE
DVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRR
IRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYN
TLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTK
LVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATH
RLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVN
IVMNYIRNGAMVRLLED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ma7 Modulation of the active complex assembly and turnover rate by protein-DNA interactions in Cre-LoxP recombination
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K43 M44 S47 R50 R81 L83 A84 K86 T87 Q90 R118 A131 K132 Q156 R159 R173 K201 T202 R241 V242 K244 L256 S257 R259 R282 W315 T316 N317 I320 Y324
Binding residue
(residue number reindexed from 1)		K24 M25 S28 R31 R62 L64 A65 K67 T68 Q71 R99 A112 K113 Q137 R140 R154 K182 T183 R222 V223 K225 L237 S238 R240 R263 W296 T297 N298 I301 Y305
Binding affinityPDBbind-CN: Kd=146nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ma7, PDBe:1ma7, PDBj:1ma7
PDBsum1ma7
PubMed12779336
UniProtP06956|RECR_BPP1 Recombinase cre (Gene Name=cre)

[Back to BioLiP]