Structure of PDB 1m7e Chain B Binding Site BS01

Receptor Information
>1m7e Chain B (length=150) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAA
AGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDN
RAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDKKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m7e Crystal structures of the Dab homology domains of mouse disabled 1 and 2
Resolution2.45 Å
Binding residue
(original residue number in PDB)
R64 D66 N119 I121 S122 F123 I124 R126 G139 E141 V159 K163 F166 Y170
Binding residue
(residue number reindexed from 1)
R33 D35 N88 I90 S91 F92 I93 R95 G108 E110 V128 K132 F135 Y139
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1m7e, PDBe:1m7e, PDBj:1m7e
PDBsum1m7e
PubMed12826668
UniProtP98078|DAB2_MOUSE Disabled homolog 2 (Gene Name=Dab2)

[Back to BioLiP]