Structure of PDB 1m72 Chain B Binding Site BS01

Receptor Information
>1m72 Chain B (length=248) Species: 7108 (Spodoptera frugiperda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLS
KVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELG
MLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLS
RTSYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERD
ILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m72 Crystal structure of an invertebrate caspase.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R79 H136 C178 F221 S222 W223 R224 N225 T226 S266 N267
Binding residue
(residue number reindexed from 1)		R39 H96 C138 F173 S174 W175 R176 N177 T178 S218 N219
Enzymatic activity
Catalytic site (original residue number in PDB) K77 S78 G137 C178
Catalytic site (residue number reindexed from 1) K37 S38 G97 C138
Enzyme Commision number 3.4.22.-
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
GO:0097199 cysteine-type endopeptidase activity involved in apoptotic signaling pathway
Biological Process
GO:0006508 proteolysis
GO:0006915 apoptotic process
GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043525 positive regulation of neuron apoptotic process
GO:0097190 apoptotic signaling pathway
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1m72, PDBe:1m72, PDBj:1m72
PDBsum1m72
PubMed14645217
UniProtP89116|CASP1_SPOFR Caspase-1

[Back to BioLiP]