Structure of PDB 1m63 Chain B Binding Site BS01

Receptor Information

>1m63 Chain B (length=158) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIF
DTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGEL
FQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDI
HKKMVVDV

Ligand information

>1m63 Chain D (length=11) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ALLVTPGLVLA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1m63 Crystal Structure of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition of Immunophilin-Drug Complexes
Resolution	2.8 Å
Binding residue (original residue number in PDB)	N122 L123
Binding residue (residue number reindexed from 1)	N111 L112

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004721	phosphoprotein phosphatase activity
GO:0004723	calcium-dependent protein serine/threonine phosphatase activity
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005516	calmodulin binding
GO:0008597	calcium-dependent protein serine/threonine phosphatase regulator activity
GO:0019902	phosphatase binding
GO:0019904	protein domain specific binding
GO:0046872	metal ion binding

	Biological Process
GO:0001569	branching involved in blood vessel morphogenesis
GO:0001837	epithelial to mesenchymal transition
GO:0006606	protein import into nucleus
GO:0007507	heart development
GO:0014044	Schwann cell development
GO:0022011	myelination in peripheral nervous system
GO:0033173	calcineurin-NFAT signaling cascade
GO:0034504	protein localization to nucleus
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0060487	lung epithelial cell differentiation
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade
GO:0097720	calcineurin-mediated signaling
GO:0098693	regulation of synaptic vesicle cycle
GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization
GO:0099170	postsynaptic modulation of chemical synaptic transmission
GO:1905665	positive regulation of calcium ion import across plasma membrane
GO:1905949	negative regulation of calcium ion import across plasma membrane

	Cellular Component
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005955	calcineurin complex
GO:0008287	protein serine/threonine phosphatase complex
GO:0042383	sarcolemma
GO:0045202	synapse
GO:0098685	Schaffer collateral - CA1 synapse
GO:0098686	hippocampal mossy fiber to CA3 synapse
GO:0098688	parallel fiber to Purkinje cell synapse
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1m63, PDBe:1m63, PDBj:1m63
PDBsum	1m63
PubMed	12218175
UniProt	P63098\|CANB1_HUMAN Calcineurin subunit B type 1 (Gene Name=PPP3R1)

[Back to BioLiP]