Structure of PDB 1ltx Chain B Binding Site BS01

Receptor Information
>1ltx Chain B (length=318) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDVTIKSDPDTLLLEKHADYIASYGSCMSEYLRMSGVYWGLTVMDLMGQL
HRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHV
INVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAIN
VEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSD
LLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKL
RSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVF
CMPEEVLQRVNVQPELVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ltx Structure of Rab Escort Protein-1 in Complex with Rab Geranylgeranyltransferase
Resolution2.7 Å
Binding residue
(original residue number in PDB)
H190 Y241 D287 F289
Binding residue
(residue number reindexed from 1)
H177 Y228 D274 F276
Enzymatic activity
Catalytic site (original residue number in PDB) H190 R232 K235 D238 C240 Y241 D280 D287 H290
Catalytic site (residue number reindexed from 1) H177 R219 K222 D225 C227 Y228 D267 D274 H277
Enzyme Commision number 2.5.1.60: protein geranylgeranyltransferase type II.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004659 prenyltransferase activity
GO:0004661 protein geranylgeranyltransferase activity
GO:0004663 Rab geranylgeranyltransferase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0008318 protein prenyltransferase activity
GO:0019840 isoprenoid binding
GO:0031267 small GTPase binding
GO:0046872 metal ion binding
Biological Process
GO:0018344 protein geranylgeranylation
Cellular Component
GO:0005968 Rab-protein geranylgeranyltransferase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1ltx, PDBe:1ltx, PDBj:1ltx
PDBsum1ltx
PubMed12620235
UniProtQ08603|PGTB2_RAT Geranylgeranyl transferase type-2 subunit beta (Gene Name=Rabggtb)

[Back to BioLiP]