Structure of PDB 1lli Chain B Binding Site BS01

Receptor Information
>1lli Chain B (length=92) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESLADKLGMGQSGIGAL
FNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lli The crystal structure of a mutant protein with altered but improved hydrophobic core packing.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		S1 K3 K4 K5 M42 G43 S45 G46 N55 N58
Binding residue
(residue number reindexed from 1)		S1 K3 K4 K5 M42 G43 S45 G46 N55 N58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1lli, PDBe:1lli, PDBj:1lli
PDBsum1lli
PubMed8278404
UniProtP03034|RPC1_LAMBD Repressor protein cI (Gene Name=cI)

[Back to BioLiP]