Structure of PDB 1lj2 Chain B Binding Site BS01

Receptor Information
>1lj2 Chain B (length=110) Species: 10923 (Simian rotavirus A/SA11) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MHSLQNVIPQQQAHIAELQVYNNKLERDLQNKIGSLTSSIEWYLRSMELD
PEIKADIEQQINSIDAINPLHAFDDLESVIRNLISDYDKLFLMFKGLIQR
SNYQYSFGSE
Ligand information
>1lj2 Chain C (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KTIRIRDPNQGGKDITEEIMSG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lj2 Recognition of eIF4G by rotavirus NSP3 reveals a basis for mRNA circularization.
Resolution2.38 Å
Binding residue
(original residue number in PDB)		M298 G301 L302 Q304
Binding residue
(residue number reindexed from 1)		M93 G96 L97 Q99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1lj2, PDBe:1lj2, PDBj:1lj2
PDBsum1lj2
PubMed12086624
UniProtP03536|NSP3_ROTS1 Non-structural protein 3

[Back to BioLiP]