Structure of PDB 1lf8 Chain B Binding Site BS01

Receptor Information

>1lf8 Chain B (length=159) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVR
LLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVS
PKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDP
PIPVDRTLI

Ligand information

>1lf8 Chain F (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SDEDLLHI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1lf8 Phosphoregulation of sorting signal-VHS domain interactions by a direct electrostatic mechanism.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	K86 F87 R88 N91 K95 S98 K100 Y101 K130 M137
Binding residue (residue number reindexed from 1)	K88 F89 R90 N93 K97 S100 K102 Y103 K132 M139

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0031267	small GTPase binding
GO:0035091	phosphatidylinositol binding
GO:0043130	ubiquitin binding

	Biological Process
GO:0006886	intracellular protein transport

	Cellular Component
GO:0005802	trans-Golgi network

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1lf8, PDBe:1lf8, PDBj:1lf8
PDBsum	1lf8
PubMed	12032548
UniProt	Q9NZ52\|GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 (Gene Name=GGA3)

[Back to BioLiP]