Structure of PDB 1lat Chain B Binding Site BS01

Receptor Information
>1lat Chain B (length=74) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARPCLVCSDEASGCHYGVLTCEGCKAFFKRAVEGQHNYLCKYEGKCIIDK
IRRKNCPACRYRKCLQAGMNLEAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lat The basis for half-site specificity explored through a non-cognate steroid receptor-DNA complex.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		E458 R466 R489 K490 P493 R496
Binding residue
(residue number reindexed from 1)		E22 R30 R53 K54 P57 R60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1lat, PDBe:1lat, PDBj:1lat
PDBsum1lat
PubMed7664096
UniProtP06536|GCR_RAT Glucocorticoid receptor (Gene Name=Nr3c1)

[Back to BioLiP]