Structure of PDB 1l1m Chain B Binding Site BS01

Receptor Information
>1l1m Chain B (length=62) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPN
RCAQQLAGKQSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1l1m Plasticity in protein-DNA recognition: lac repressor interacts with its natural operator 01 through alternative conformations of its DNA-binding domain.
ResolutionN/A
Binding residue
(original residue number in PDB)		T5 L6 Y7 Y17 Q18 S21 R22 N25 Q26 N50 A53 Q54 A57
Binding residue
(residue number reindexed from 1)		T5 L6 Y7 Y17 Q18 S21 R22 N25 Q26 N50 A53 Q54 A57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1l1m, PDBe:1l1m, PDBj:1l1m
PDBsum1l1m
PubMed12065400
UniProtP03023|LACI_ECOLI Lactose operon repressor (Gene Name=lacI)

[Back to BioLiP]