Structure of PDB 1kl5 Chain B Binding Site BS01

Receptor Information
>1kl5 Chain B (length=120) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGITGTWYNQLGSTFIVTAGADGALTGTYIGARGNAESRYVLTGRYDSAP
ATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGT
TEANAWKSTLVGHDTFTKVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kl5 Improved affinity of engineered streptavidin for the Strep-tag II peptide is due to a fixed open conformation of the lid-like loop at the binding site.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y54 W79 R84 S88 T90 W92 W108 L110
Binding residue
(residue number reindexed from 1)		Y40 W65 R70 S74 T76 W78 W94 L96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1kl5, PDBe:1kl5, PDBj:1kl5
PDBsum1kl5
PubMed11910031
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]