Structure of PDB 1k78 Chain B Binding Site BS01

Receptor Information
>1k78 Chain B (length=102) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKM
NYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLD
VK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1k78 Structural studies of Ets-1/Pax5 complex formation on DNA.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		R391 R394 Y397 K404 R409
Binding residue
(residue number reindexed from 1)		R57 R60 Y63 K70 R75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1k78, PDBe:1k78, PDBj:1k78
PDBsum1k78
PubMed11779502
UniProtP27577|ETS1_MOUSE Protein C-ets-1 (Gene Name=Ets1)

[Back to BioLiP]